Website Information
    Web Site Information :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

01ibm.com: IBM Unix Server and Parts ,RS6000 PARTS,P5 server parts,AS400 server and Parts
IBM Unix Server and Parts,IBM RS6000, IBM P5 SERVER, IBM server parts,IBM used server and parts, IBM used RS6000 server and parts,IBM used p5 server and parts,p550,p570,RS6000,AS400  
 
 

IBM Unix Server and Parts ,RS6000 PARTS,P5 server parts,AS400 server and Parts

Description: IBM Unix Server and Parts,IBM RS6000, IBM P5 SERVER, IBM server parts,IBM used server and parts, IBM used RS6000 server and parts,IBM used p5 server and parts,p550,p570,RS6000,AS400

Keywords: IBM Unix Server and Parts, IBM RS6000, IBM P5 SERVER, IBM server parts, IBM used server and parts, IBM used RS6000 server and parts, IBM used p5 server and parts, p550, p570, RS6000, AS400

Tags: 01ibm, parts, ibm, server, simplified, chinese, used, unix, finnish, french, german, japanese, korean, spanish, english, russian, search, sell, contact, equipment, quote, request, storage, time, ocean, group, banner, rss, atom, quotesell, products, home, copyright, series, equipmentabout, uscontact, iseries, pseriesp, homeproductsrequest, croatianczechdanishdutchfinnishfrenchgermangreekhindiitalianjapanesekoreannorwegianpolishportugueseromanianrussianspanishswedishcatalanfilipinohebrewindonesianlatvianlithuanianserbianslovakslovenianukrainianvietnamesealbanianestoniangalicianhungarianmaltesethaiturkishpersianafrikaansmalayswahiliirishwelshbelarusianicelandicmacedonianyiddish,

01ibm.com

Content Revalency: Title: 37.50%   Description: 44.44%   Keywords: 44.44%  |  Document size: 26,058 bytes
More info: Whois - Trace Route - RBL Check
 
 
01IBM.COM - Site Location
Country/Flag US United States
City/Region/Zip Code Atlanta, Georgia 30310
Organization WebHostingBuzz USA LLC
Internet Service Provider Global Net Access, LLC
 
01IBM.COM - Domain Information
Domain 01IBM.COM   [ Traceroute  RBL/DNSBL lookup ]
Registrar ENOM, INC.
Registrar URL http://www.enom.com
Whois server whois.enom.com
Created 13-Jan-2010
Updated 16-Dec-2010
Expires 13-Jan-2012
Time Left 0 days 0 hours 0 minutes
Status clientTransferProhibited
DNS servers NS113.NAMECHEAPHOSTING.COM   64.22.76.44
NS13.NAMECHEAPHOSTING.COM   74.81.78.94
 
01IBM.COM - DNS Information
IP Address 64.22.76.44 ~ Whois - Trace Route - RBL Check
Domain Name Servers ns13.namecheaphosting.com   74.81.65.92
ns113.namecheaphosting.com   69.65.41.209
Mail Exchange 01ibm.com   198.105.189.123
 
Site Response Header
Response HTTP/1.1 200 OK
Server Apache
Date Wed, 06 Apr 2011 16:49:54 GMT
Content-Type text/html; charset=utf-8
Cookie 51dd58f4bf970a986d4fa83f51a71250=61b67629c36847acbc40ee241f4ed4ec; path=/


  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com