Enter Domain Name:
01ibm.com: IBM Unix Server and Parts ,RS6000 PARTS,P5 server parts,AS400 server and Parts
IBM Unix Server and Parts,IBM RS6000, IBM P5 SERVER, IBM server parts,IBM used server and parts, IBM used RS6000 server and parts,IBM used p5 server and parts,p550,p570,RS6000,AS400

IBM Unix Server and Parts ,RS6000 PARTS,P5 server parts,AS400 server and Parts

Description: IBM Unix Server and Parts,IBM RS6000, IBM P5 SERVER, IBM server parts,IBM used server and parts, IBM used RS6000 server and parts,IBM used p5 server and parts,p550,p570,RS6000,AS400

Keywords: IBM Unix Server and Parts, IBM RS6000, IBM P5 SERVER, IBM server parts, IBM used server and parts, IBM used RS6000 server and parts, IBM used p5 server and parts, p550, p570, RS6000, AS400

Tags: 01ibm, parts, ibm, server, simplified, chinese, used, unix, finnish, french, german, japanese, korean, spanish, english, russian, search, sell, contact, equipment, quote, request, storage, time, ocean, group, banner, rss, atom, quotesell, products, home, copyright, series, equipmentabout, uscontact, iseries, pseriesp, homeproductsrequest, croatianczechdanishdutchfinnishfrenchgermangreekhindiitalianjapanesekoreannorwegianpolishportugueseromanianrussianspanishswedishcatalanfilipinohebrewindonesianlatvianlithuanianserbianslovakslovenianukrainianvietnamesealbanianestoniangalicianhungarianmaltesethaiturkishpersianafrikaansmalayswahiliirishwelshbelarusianicelandicmacedonianyiddish,

01ibm.com

Content Revalency: Title: 37.50%   Description: 44.44%   Keywords: 44.44%  |  Document size: 26,058 bytes
More info: Whois - Trace Route - RBL Check
01IBM.COM - Site Location
Country/Flag US United States
City/Region/Zip Code Spring, Texas, 77393
Organization Global Net Access, LLC
Internet Service Provider Global Net Access, LLC
01IBM.COM - Domain Information
Domain 01IBM.COM   [ Traceroute  RBL/DNSBL lookup ]
Registrar REGISTER.COM, INC. Register.com, Inc.
Registrar URL http://www.register.com
Whois server whois.register.com
Created 19-Sep-2014
Updated 31-Oct-2015
Expires 19-Sep-2016
Time Left 0 days 0 hours 0 minutes
Status clientTransferProhibited https://icann.org/epp#clientTransferProhibited clientTransferProhibited http://icann.org/epp#clientTransferProhibited
DNS servers SK.S5.CM.NS1.37.ZTOMY.COM   74.54.152.117
SK.S5.CM.NS2.37.ZTOMY.COM   74.54.152.197
sk.s5.cm.ns2.37.ztomy.com   74.54.152.197
sk.s5.cm.ns1.37.ztomy.com   74.54.152.117
01IBM.COM - DNS Information
IP Address 64.22.76.44 ~ Whois - Trace Route - RBL Check
Domain Name Servers ns13.namecheaphosting.com   216.87.155.33
ns113.namecheaphosting.com   216.87.152.33
Mail Exchange 01ibm.com   208.91.197.46
Site Response Header
Response HTTP/1.1 200 OK
Server Apache
Date Wed, 06 Apr 2011 16:49:54 GMT
Content-Type text/html; charset=utf-8
Cookie 51dd58f4bf970a986d4fa83f51a71250=61b67629c36847acbc40ee241f4ed4ec; path=/