Eksit
Description: Joomla! - dünaamiline portaali mootor ja sisuhaldussüsteem
Keywords: joomla, Joomla
Tags: eksit, joomla, xhtml, css, atom, rss, kasutataud, valideeruv, ülesfailidtimetraktimesheetpayrollparameetridreporthousnoteshours, tarkvara, homelae, fail, main, menu, dünaamiline, portaali, sisuhaldussüsteem, mootor,
Eksit.net
|
Content Revalency:
Title: 100.00%
Description: 16.67%
Keywords: 100.00% | Document size: 5,464 bytes
More info: Whois - Trace Route - RBL Check |
|
| EKSIT.NET - Site Location | |
| Country/Flag | |
| City/Region/Zip Code | Tallinn, Harjumaa, |
| Organization | Eesti Telekom |
| Internet Service Provider | Eesti Telekom |
| EKSIT.NET - DNS Information | |
| IP Address | 213.180.31.150 ~ Whois - Trace Route - RBL Check |
| Domain Name Servers | ns.elkdata.ee 194.106.101.162 ns2.elkdata.ee 194.106.101.163 ns3.elkdata.net 195.222.17.113 |
| Mail Exchange | mh1.elkdata.ee 185.7.252.14 mh3.elkdata.ee 213.180.31.146 |
| Site Response Header | |
| Response | HTTP/1.1 200 OK |
| Server | Apache/2.2.17 (FreeBSD) mod_ssl/2.2.17 OpenSSL/1.0.0b DAV/2 mod_fcgid/2.3.6 |
| Date | Mon, 11 Apr 2011 05:00:11 GMT |
| Content-Type | text/html; charset=utf-8 |
| Cookie | 5a19d6183ba56e6a0f6bb64fa9bfe01a=33ae526e98d4516cdfa096a1f47d08ea; path=/ |