The Official Evrite Software Site
Description: 701SD / 707 Account Books, A4 8 Column Account Pads, Payslips & Mailers, 707 Bookkeeping Software. Find all these products at the official home of Evrite.
Keywords: 707, 707 Books, Account Books, 701, 701 Books, Account Pads, 268a, 268A, 26/8A, Analysis Pads, Evrite, accounting software, account software, business accounting software, accounting software uk, software package, accounting software solution, evrite software, evrite accounting software, Bookkeeping, Account books, Accounts, Accounting, bookkeeping software, Bookkeeping Software, Evrite Limited, Evrite Software, Accountants, Local Accountants, Local Accountant, Bookkeepers, Book Keeping, Simplex, Collins, Simplex D, Quick Books, Quicken, Sage, Pegasus, Master Mailer, Payslips, Everseal, Mailers
Tags: evritesoftware, software, evrite, official, menu, site, accounting, account, products, books, bookkeeping, bgcolor=, writemenus, mmloadmenus, hiding, stop, softwareabout, usbooksmailers, monday, usdownload, faqcontact, softwarepricesnewslinkssitemaphelp, excluding, asap, friday, menulitebgcolor=, despatch, demo, menuborder=, anytime, hideonmouseout=true, menuborderbgcolor=, bank, holidays, view, order, pads, mailers, payslips, column,
Evritesoftware.co.uk
|
Content Revalency:
Title: 40.00%
Description: 15.00%
Keywords: 9.09% | Document size: 23,319 bytes
More info: Whois - Trace Route - RBL Check |
|
| EVRITESOFTWARE.CO.UK - Site Location | |
| Country/Flag | |
| City/Region/Zip Code | Edinburgh, Edinburgh, City of, EH1 |
| Organization | Xtraordinary Edinburgh Partition |
| Internet Service Provider | Extraordinary Managed Services Ltd |
| EVRITESOFTWARE.CO.UK - DNS Information | |
| IP Address | 82.113.136.29 ~ Whois - Trace Route - RBL Check |
| Domain Name Servers | ns2.az-dns.com ns1.az-dns.com |
| Mail Exchange | mail.evritesoftware.co.uk 82.113.155.77 |
| Site Response Header | |
| Response | HTTP/1.1 200 OK |
| Server | Microsoft-IIS/6.0 |
| Date | Mon, 11 Apr 2011 09:04:19 GMT |
| Content-Type | text/html; Charset=iso-ir-6 |
| Cookie | ASPSESSIONIDCQSBDACD=NPHBGFMAEMLDNGGCCCAEEHHC; path=/ |