Enter Domain Name:
evritesoftware.co.uk: The Official Evrite Software Site
701SD / 707 Account Books, A4 8 Column Account Pads, Payslips & Mailers, 707 Bookkeeping Software. Find all these products at the official home of Evrite.

The Official Evrite Software Site

Description: 701SD / 707 Account Books, A4 8 Column Account Pads, Payslips & Mailers, 707 Bookkeeping Software. Find all these products at the official home of Evrite.

Keywords: 707, 707 Books, Account Books, 701, 701 Books, Account Pads, 268a, 268A, 26/8A, Analysis Pads, Evrite, accounting software, account software, business accounting software, accounting software uk, software package, accounting software solution, evrite software, evrite accounting software, Bookkeeping, Account books, Accounts, Accounting, bookkeeping software, Bookkeeping Software, Evrite Limited, Evrite Software, Accountants, Local Accountants, Local Accountant, Bookkeepers, Book Keeping, Simplex, Collins, Simplex D, Quick Books, Quicken, Sage, Pegasus, Master Mailer, Payslips, Everseal, Mailers

Tags: evritesoftware, software, evrite, official, menu, site, accounting, account, products, books, bookkeeping, bgcolor=, writemenus, mmloadmenus, hiding, stop, softwareabout, usbooksmailers, monday, usdownload, faqcontact, softwarepricesnewslinkssitemaphelp, excluding, asap, friday, menulitebgcolor=, despatch, demo, menuborder=, anytime, hideonmouseout=true, menuborderbgcolor=, bank, holidays, view, order, pads, mailers, payslips, column,

Evritesoftware.co.uk

Content Revalency: Title: 40.00%   Description: 15.00%   Keywords: 9.09%  |  Document size: 23,319 bytes
More info: Whois - Trace Route - RBL Check
EVRITESOFTWARE.CO.UK - Site Location
Country/Flag GB United Kingdom
City/Region/Zip Code Edinburgh, Edinburgh, City of, EH1
Organization Xtraordinary Edinburgh Partition
Internet Service Provider Extraordinary Managed Services Ltd
EVRITESOFTWARE.CO.UK - DNS Information
IP Address 82.113.136.29 ~ Whois - Trace Route - RBL Check
Domain Name Servers ns2.az-dns.com  
ns1.az-dns.com  
Mail Exchange mail.evritesoftware.co.uk   82.113.155.77
Site Response Header
Response HTTP/1.1 200 OK
Server Microsoft-IIS/6.0
Date Mon, 11 Apr 2011 09:04:19 GMT
Content-Type text/html; Charset=iso-ir-6
Cookie ASPSESSIONIDCQSBDACD=NPHBGFMAEMLDNGGCCCAEEHHC; path=/