D&D Sourcebooks - Home
Description: This shopping guide will help you find the best roleplaying game sourcebooks for Dungeons and Dragons and other RPGs.
Keywords: shopping guide, D&D sourcebooks, D&D rulebooks, shopping, D&D, sourcebook, rulebook, Dungeons and Dragons, D20, RPG, RP, roleplay, book, source, guide, amazon, LARP, costumes
Tags: gamerprofiles, rss, feed, sourcebooks, home, guide, roleplaying, fantasy, shopping, dragons, plane, astral, dungeons, planescape, costumes, larp, replicas, planar, handbook, sea, supplement, edition, museum, secrets, dungeon, classesarcherbardclericdruidmagemonkpaladinpsionicrogueshamanwarriorracesanimaldragondrowdwarfelfgolemhybridmonsterorcsettingseberronforgotten, links, games, ocarinacng, copyright, realmsgreyhawkplanesplanescapesteampunk, recent, real, like, welcome, life, check, gear, rpg, roleplay,
Gamerprofiles.org
Content Revalency:
Title: 0.00%
Description: 27.78%
Keywords: 33.33% | Document size: 6,084 bytes
More info: Whois - Trace Route - RBL Check |
![]() ![]() ![]() |
GAMERPROFILES.ORG - Site Location | |
Country/Flag | ![]() |
City/Region/Zip Code | Orem, Utah, 84097 |
Organization | Unified Layer |
Internet Service Provider | Unified Layer |
GAMERPROFILES.ORG - DNS Information | |
IP Address | 74.220.207.89 ~ Whois - Trace Route - RBL Check |
Domain Name Servers | ns2.hostmonster.com 162.159.25.186 ns1.hostmonster.com 162.159.24.157 |
Mail Exchange | gamerprofiles.org 64.98.145.30 |
Site Response Header | |
Response | HTTP/1.1 200 OK |
Server | Apache |
Date | Mon, 11 Apr 2011 18:27:46 GMT |
Content-Type | text/html |
Cookie | CAKEPHP=1e0e1ef2b5ab645037b9888e78ff9c62; path=/ |