Lotus Mobile Software's home page
Description: Lotus Mobile Software - the mobile software solutions company
Keywords: Lotus Mobile Software
Tags: lotusmobilesoftware, software, mobile, lotus, solutions, gpl, joomla, license, gnu, web, home, page, rss, atom, example, chinese, flash, player, company, free, released, class, englisharabicbulgariancroatianczechdanishdutchfinnishfrenchgermangreekhindiitalianjapanesekoreannorwegianpolishportugueseromanianrussianspanishswedishcatalanfilipinohebrewindonesianlatvianlithuanianserbianslovakslovenianukrainianvietnamesealbanianestoniangalicianhungarianmaltesethaiturkishpersianafrikaansmalayirishbelarusianicelandicmacedonianarmenianazerbaijanibasquegeorgianhaitian, creolechinese, order, reserved, linksfaq, uscontactsnewsweb, homeabout, object, view, rights, powered, copyright, need, support,
Lotusmobilesoftware.com
|
Content Revalency:
Title: 16.67%
Description: 33.33%
Keywords: 33.33% | Document size: 24,044 bytes
More info: Whois - Trace Route - RBL Check |
|
| LOTUSMOBILESOFTWARE.COM - Site Location | |
| Country/Flag | |
| City/Region/Zip Code | Hanoi, Ha Noi, |
| Organization | FPT Telecom Company |
| Internet Service Provider | The Corporation for Financing and Promoting Techno |
| LOTUSMOBILESOFTWARE.COM - Domain Information | |
| Domain | LOTUSMOBILESOFTWARE.COM [ Traceroute RBL/DNSBL lookup ] |
| Registrar | INTERWEB ADVERTISING D.B.A. PROFILE BUILDER ProfileBuilder.com LLC |
| Registrar URL | http://www.profilebuilder.com |
| Whois server | whois.profilebuilder.com |
| Created | 07-Nov-2015 |
| Updated | 07-Nov-2015 |
| Expires | 07-Nov-2016 |
| Time Left | 0 days 0 hours 0 minutes |
| Status | clientTransferProhibited https://icann.org/epp#clientTransferProhibited clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited |
| DNS servers | NS1.MYTRAFFICMANAGEMENT.COM 50.56.223.248 NS2.MYTRAFFICMANAGEMENT.COM 50.56.241.173 ns2.mytrafficmanagement.com 50.56.241.173 ns1.mytrafficmanagement.com 50.56.223.248 |
| LOTUSMOBILESOFTWARE.COM - DNS Information | |
| IP Address | 210.245.90.196 ~ Whois - Trace Route - RBL Check |
| Domain Name Servers | ns26.hostvn.net 210.245.90.196 ns25.hostvn.net 210.245.90.196 |
| Mail Exchange | lotusmobilesoftware.com 45.33.9.234 |
| Site Response Header | |
| Response | HTTP/1.0 200 OK |
| Date | Wed, 13 Apr 2011 12:06:48 GMT |
| Content-Type | text/html; charset=utf-8 |
| Cookie | 517715d933425c20406d3df65ec7519f=e6130249295a6c7a90ed3e9c62c143a9; path=/ |