Enter Domain Name:
ncsts.net: JOIN
Official home of Chimney Sweeps Association of Ireland. Our members can clean chimneys, flue installations, stove installations, chimney lining for solid fuel fires/stoves, Insurance reports and surveys

JOIN

Description: Official home of Chimney Sweeps Association of Ireland. Our members can clean chimneys, flue installations, stove installations, chimney lining for solid fuel fires/stoves, Insurance reports and surveys

Keywords: clean chimneys, flue installations, stove installations, chimney lining solid fuel fires stoves, Insurance reports and surveys

Tags: ncsts, join, mail, color, csiacertifiedchimneysweeptrademark, jpg, print, pdf, search, members, home, chimney, arrow, installations, service, safety, products, contact, wood, building, aaronkenny, com, services, administrator, international, regulations, apply, tgd, fuel, fires, stoves, clean, lining, stove, chimneys, solid, flue, insurance, surveys, reports,

Ncsts.net

Content Revalency: Title: 100.00%   Description: 24.00%   Keywords: 6.67%  |  Document size: 15,832 bytes
More info: Whois - Trace Route - RBL Check
NCSTS.NET - Site Location
Country/Flag GB United Kingdom
City/Region/Zip Code , ,
Organization Digiweb ltd
Internet Service Provider Digiweb ltd
NCSTS.NET - DNS Information
IP Address 78.137.164.60 ~ Whois - Trace Route - RBL Check
Domain Name Servers ns7.dnsireland.ie   78.157.219.21
ns5.dnsireland.com   212.126.59.9
ns6.dnsireland.com   178.62.91.160
Mail Exchange ncsts.net  
Site Response Header
Response HTTP/1.1 301 Moved Permanently
Server Apache/2.2.11 (Unix)
Date Thu, 14 Apr 2011 17:48:41 GMT
Content-Type text/html
Cookie mosvisitor=1