Enter Domain Name:
zinderkoch.com
Zinder & Koch, lawyers in Glendale, CA
NORTH HOLLYWOOD, N HOLLYWOOD, CA, California lawyers focusing on, Construction, Employment, Insurance
Zinderkoch.com  ~ Site Info Whois Trace Route RBL Check
kaisermedicalmalpracticeattorney.com
Home
Contact personal injury and medical malpractice attorney Scott S. Harris in San Diego, California, to schedule a free legal consultation. Call 866-934-2432.
Kaisermedicalmalpracticeattorney.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: kaisermedicalmalpracticelawyer.com - scottsharrislaw.com
bbroussardlaw.com
Bob Broussard Law | Lafayette Louisiana
Bob Broussard, APLC is a private law corporation devoted to representing those who have been injured. Since 1982, Bob Broussard has handled thousands of personal injury cases, including Jones Act, LHWCA OSCLA, Admiralty and Maritime Law, Fixed Platform and Offshore Injury Cases, and vessel collision.
Bbroussardlaw.com  ~ Site Info Whois Trace Route RBL Check
disabilitylawfirm.com
Home
Experienced Southern California Social Security Disability claims lawyers. Contact us for a free consultation. 1-562-219-4156 or 1-866-764-0321.
Disabilitylawfirm.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: judithleland.com
fetchmybooks.com
Welcome to UrbanGive.com
Give to your organization by your everyday online shopping with UrbanGive.com!
Fetchmybooks.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: urbangive.com
pachowicz.com
Home
At the Law Offices of Mark R. Pachowicz, our Ventura County, California lawyers work in criminal law, family law, business law, and other legal matters.
Pachowicz.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: packowicz.com - packowitz.com
sendible.com
Social Media Management Software for Businesses: Sendible
Sendible is a social media marketing platform that helps you engage with your audience and promote, track and monitor your brand across multiple social media channels at any time.
Sendible.com  ~ Site Info Whois Trace Route RBL Check
douglassgilliland.com
Douglas S. Gilliland, Esq., Trial Lawyer from San Diego, CA Home
Doug Gilliland lawyer san diego attorney
Douglassgilliland.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: sandiegotriallawyers.com
paulameyerlaw.com
Orange CA Real Estate Law Firm | Business & Employment Attorney California Orange County
If you have legal concerns in real estate, business or employment law, contact PAULA E. MEYER & ASSOCIATES, APLC of Orange, California, at 866-409-9415 to schedule an appointment with a qualified attorney.
Paulameyerlaw.com  ~ Site Info Whois Trace Route RBL Check
Go to page: