Enter Domain Name:
automationdirect.biz
Domain Names, Web Hosting and Online Marketing Services | Network Solutions
Find domain names, web hosting and online marketing for your website -- all in one place. Network Solutions helps businesses get online and grow online with domain name registration, web hosting and innovative online marketing services.
Automationdirect.biz  ~ Site Info Whois Trace Route RBL Check

Similar Sites: automationdirect.info
aboutplcs.com
AboutPLCs.com from AutomationDirect: #1 value in automation and industrial control
AboutPLCs from AutomationDirect. Your source for the #1 value in PLC programming, PLC Direct products, PLCs and PLC control
Aboutplcs.com  ~ Site Info Whois Trace Route RBL Check
lamonde-automation.com
Welcome
Lamonde Automation - Industrial Automation & Control products: PLCs, PC Control & Field I/O, Operator Interfaces (HMI/SCADA), AC Drives, Motors & Control Gear, Sensors, Encoders & Switches, Control Panel Hardware, Power Supplies, Process Control & Interface, Networks & Communications
Lamonde-automation.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: lamondeautomation.com - plcdirect.co.uk
adcpn.com
The best way to buy industrial controls--low prices, fast shipping and superior service.
AutomationDirect - Industrial control products: PLCs, AC Drives, Operator Interfaces, Enclosures, Pushbuttons, Sensors, Motor Controls, Power Supplies, and more!
Adcpn.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: automation-direct.com - plcdirect.com
automation-controls.com
Automation Controls - Home
 Automation Controls a licensed (CA) electrical engineering consulting firm. Automation Controls designs, programs, and troubleshoots PLC/HMI systems and associated wiring, instrumentation, and electro-mechanical components on industrial machinery. AC wo
Automation-controls.com  ~ Site Info Whois Trace Route RBL Check
ljbeng.com
LJB Engineering
Electrical engineering and custom design. Datalog to compact flash and SD card for AutomationDirect PLC systems.
Ljbeng.com  ~ Site Info Whois Trace Route RBL Check
plccompare.com
PLC Compare | Helping you Research and Compare PLCs
PACs (Programmable Automation Controllers): The high end of the PLC market.  Tend to have more advanced communication options, use named locations (Tags) instead of memory addresses and perform complex functions including...
Plccompare.com  ~ Site Info Whois Trace Route RBL Check
necelectricalsafetymarketplace.com
NFPA NEC Electrical Safety Marketplace
NFPA NEC Electrical Safety Marketplace - The NEC Electrical Safety Marketplace is the database dedicated to engineers, electrical designers, contractors, architects, and installers, helping them find the products & services they need.
Necelectricalsafetymarketplace.com  ~ Site Info Whois Trace Route RBL Check
shopquantumautomation.com
Quantum Automation
Providing the most practical industrial control solutions, including PLCs, operator interfaces, software, drives, motors, sensors, Ethernet devices an
Shopquantumautomation.com  ~ Site Info Whois Trace Route RBL Check
aicontrols.com
Control Systems Integration | Industrial Automation Controls | PLC Programming – AI Control Systems
Control Systems Integration through AI Control Systems helps to streamline operations through automation by connecting hardware with software and infrastructure to improve efficiency and overall capabilities.
Aicontrols.com  ~ Site Info Whois Trace Route RBL Check
Page 1/4« Previous1234Next »
Go to page: