Enter Domain Name:
keislertv.com
KEISLER TV // on the PowerTV Network
Overdrive Transmissions for Musclecar, Street Rod and Corvette. Channel features up to date videos of Product, Installation, Driving and Customer Testimonials.
Keislertv.com  ~ Site Info Whois Trace Route RBL Check
goldenjubileefarms.com
Keisler's Mill | Grits Polenta Cornmeal | Stone Ground
Water powered stone ground Grits, Polenta, Cornmeal using locally grown corn in the Midlands of South Carolina.
Goldenjubileefarms.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: keislersmill.com
keislerleelaw.com
Fairfax and Williamsburg Virginia Family Lawyers Keisler Lee, PLLC Attorneys at Law
The Fairfax Virginia family lawyers of Keisler Lee, PLLC focus on divorce, child custody and support litigation in Virginia.
Keislerleelaw.com  ~ Site Info Whois Trace Route RBL Check
moparoverdrive.com
Mopar 5 Speed Transmissions | mopar transmission conversion | transmission swap
Keisler Engineering provides Mopar 5 Speed, mopar transmission swap, Keisler Mopar products. Provides top quality transmission conversion for Mopar 5 Speed, Mopar Speed, Keisler Mopar products.
Moparoverdrive.com  ~ Site Info Whois Trace Route RBL Check
cmglovertherapy.com
Home: Individual Therapy | Couples Therapy | {515 Keisler Dr., Suite 104, Cary, NC 27518}
Charles Marshall Glover provides counseling and therapy services for individuals and couples in and around Cary, NC.
Cmglovertherapy.com  ~ Site Info Whois Trace Route RBL Check
autokeisler.com
Tremec | 5-speed | 6-speed transmission | classic car restoration | hydraulic clutch kit | Keisler Engineering - KeislerAuto.com
5-speed transmission, 6-speed transmission,tremec, hydraulic clutch kit, mopar transmission conversions for ford, chevy and dodge transmissions by Keisler Engineering
Autokeisler.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: chevy5speedclassic.com - chevy5speed.com - chrysler5speed.com - classictrany.com - ford5speed.com - gm5speed.com - keislerauto.com - mopartransmissions.com - mustangtransmissions.org - tremactransmissions.com
borghi.org
M B F A - Mark Borghi Fine Art Inc
Mark Borghi Fine Art Inc. is located at 52 East 76th Street, New York, New York. Mr. Borghi with 25 years of experience has organized one-man exhibitions on Rudolph Bauer, William Adolphe Bougoereau, Giorgio DeChirico, Wilfrid Gabriel DeGlehn, Marsden Hartley, George Inness, Joaquin Torres-Garcia and Elihu Vedder. Today the gallery's main focus is American Modernism. We currently have works by Milton Avery, Arthur B. Carles, Stuart Davis, Willem de Kooning, Rockwell Kent, Marsden Hartley, John Marin, Georgia O'Keefe, Charles Sheeler and many others.
Borghi.org  ~ Site Info Whois Trace Route RBL Check
caryfamilypracticeandwalkinclinic.com
Cary Family Practice and Walk-In Clinic - Home
We are accepting new patients  We accept most insurance plans        
Caryfamilypracticeandwalkinclinic.com  ~ Site Info Whois Trace Route RBL Check
keislerrealestate.com
Hickory NC Real Estate, Hickory Real Estate, Hickory, Real Estate
The Keisler Real Estate Team at Realty Executives | Hickory NC Real Estate | Assisting real estate buyers and home sellers all over the Hickory NC area, we specialize in listing and selling Hickory NC Real Estate. Relocating to Hickory NC - Call us today! (828) 291-5311
Keislerrealestate.com  ~ Site Info Whois Trace Route RBL Check
Page 1/3« Previous123Next »
Go to page: