Enter Domain Name:
wallyssubs.com
Wally's Sandwich Bar
Menu, sandwich slips and directions
Wallyssubs.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: wallysubs.com
douglasr.com
Douglas R - A blog about Website Development along with Tech & Gaming News
A blog about Website Development along with Tech & Gaming News
Douglasr.com  ~ Site Info Whois Trace Route RBL Check
edenisle.com
Welcome to the Frontpage
Joomla! - the dynamic portal engine and content management system
Edenisle.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: phatprint.com
plyc.info
Pelican Lake Yacht Club
Sailing activites and education
Plyc.info  ~ Site Info Whois Trace Route RBL Check
oldlymedockcompany.com
The Old Lyme Dock Company, Old Lyme, CT Discount Marine Fuel for CT River and Long Island Sound!
The Old Lyme Dock Company is Long Island Sound and the CT River's premier fuel dock and full service marina! The Old Lyme Dock Company features discount marine fuel for boaters on the Connecticut River and Long Island Sound. We offer the best dockside service plus a variety of amenities for any size boat.
Oldlymedockcompany.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: thesafegift.com
brickslip.com
www.brickslip.co.uk
Information about brick slip usage and manufacture
Brickslip.com  ~ Site Info Whois Trace Route RBL Check
slipsandfallslawyermeridenct.com
Connecticut Slips And Falls Accident Lawyer, Attorney Steve Jacobs, slipsandfalls accident injury lawyer Connecticut, Jacobs and Jacobs P.C.
The Law office of Slips And Falls Accident Attorney - Lawyer Jacobs and Jacobs in Meriden, CT
Slipsandfallslawyermeridenct.com  ~ Site Info Whois Trace Route RBL Check
sweetpotatoplant.com
Steele Plant Company - Sweet Potato Vines, Sweet Potato Slips, Onions
Steele Plant Company provides growers with a quality, certified sweet potato vine or slip direct from our Tennessee farm.
Sweetpotatoplant.com  ~ Site Info Whois Trace Route RBL Check
vdmode.com
Schiesser Unterwäsche Shop: / Λ \ ← Slips und mehr von SCHIESSER
Der große SCHIESSER Unterwäsche Shop liefert frei Haus: Original Feinripp & Doppelripp; Bluebird Slip, Inspiration Tagwäsche und den Schiesser Schlafanzug
Vdmode.com  ~ Site Info Whois Trace Route RBL Check

Similar Sites: vdmode.de
800labguys.com
DynoTech Dental Laboratories Dental Lab Corona CA Crowns Bridges Implants Veneers Full Service Lab
DynoTech Dental Laboratories is a full service dental lab located in Corona CA. We specialize in Crowns Bridges Implants Veneers, metal free restoration
800labguys.com  ~ Site Info Whois Trace Route RBL Check
Go to page: